Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFTCFIIHRTTIPYFVSQEVYWKVRNIEAEAIRRNCERGAIFS--GKIKYHEDSQFKGDHYVECYAVLDNTVIARDRITVPIDPLCGKDFIE 4L0Q Chain:A ((114-172)) ----------------------KVRSATGVGIMMN-DRKSRFSVNGKPIYH----FMGTSTFSQYTVVHDVSVAKIDPTAPLDKVC------

General information: TITO was launched using: RESULT: Template: 4L0Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 131 -9652 -73.68 -169.32 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -73.68 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.120

(partial model without unconserved sides chains): PDB file : Tito_4L0Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L0Q-query.scw PDB file : Tito_Scwrl_4L0Q.pdb: