Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTDEKEVNHLIKYAMFDKEQKRGYK-QSARNLANWHYNDKEDSYTHPDGWYYRFHHTKYQKTQTDFQQEIKVYYADEPESAPQKGLYMNERYQNLKAKEAFICPKTDFRSTQD 4L62 Chain:A ((13-84)) -------------------------------------------------------GYRIMAVKGFSGVGLNEILQSAGVPKGSFYHYFKSKEQFGQALLEDYFRVYLADMDQRFSAPGLNARERLMS-------------------

General information: TITO was launched using: RESULT: Template: 4L62.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 140 6968 49.77 98.14 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 49.77 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.64 QMean score : -0.138

(partial model without unconserved sides chains): PDB file : Tito_4L62.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L62-query.scw PDB file : Tito_Scwrl_4L62.pdb: