Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIDLYLSKNRQRNQLLLDFFQNYGIEVSCHSVSEMTKDKLIEMMSYSSDCFEFLSPNLLRFKNRDNLRLTDFVEIILKNPELTIRLPLAVSNKRVYPSLNLEEARALLPRDTKQLIYMAQTHYLSN 3IHQ Chain:A ((49-116)) ----------------------------------MTEDGTDEIISTRSKVFQKLNVNV------ESMPLQDLYRLINEHPGL-LRRPIIIDEKRLQVGYNEDEIRRFLP-----------------

General information: TITO was launched using: RESULT: Template: 3IHQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 161 -27181 -168.82 -399.71 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -168.82 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.342

(partial model without unconserved sides chains): PDB file : Tito_3IHQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IHQ-query.scw PDB file : Tito_Scwrl_3IHQ.pdb: