Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVNRLMAILNPIMMGISSGLSVAIYWIGAYVINDAAPIARLPFFSDMIVFMSYAM 4MRS Chain:B ((264-308)) -----SLGLLNIAQALIVNLLMAGAMAWTVYGWSQGK----LT-VGDLVFVNTYL-

General information: TITO was launched using: RESULT: Template: 4MRS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 51 -14827 -290.73 -329.49 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : -290.73 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.025

(partial model without unconserved sides chains): PDB file : Tito_4MRS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4MRS-query.scw PDB file : Tito_Scwrl_4MRS.pdb: