Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQIYLNGELTDTPSQNLLQLIQELALEGKRFAVEHNQQIVPKSKLEQISIAQHDRIEIIHAVGGG 1TYG Chain:B ((42-86)) -------------------LLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGG-

General information: TITO was launched using: RESULT: Template: 1TYG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 102 -23287 -228.30 -517.48 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.75 3D Compatibility (PKB) : -228.30 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.457

(partial model without unconserved sides chains): PDB file : Tito_1TYG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TYG-query.scw PDB file : Tito_Scwrl_1TYG.pdb: