Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWIAISALNLAFAVMLGAFGAHGLKAHASPEQLAWWQTATDYFFYHALGLLALGILSKVLPHFPIKLSFLLIQIGILFFCGSLYIMALGLPRILGAITPIGGALMIAGWLILAWNAFKYAK 5AZC Chain:A ((193-229)) ----------------------------------------------------------VLPRHPSQLYELLLEGVVLFIILNLYIRK---PRPMGAVS-----------------------

General information: TITO was launched using: RESULT: Template: 5AZC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 21 -6342 -302.00 -171.41 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -302.00 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.362

(partial model without unconserved sides chains): PDB file : Tito_5AZC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AZC-query.scw PDB file : Tito_Scwrl_5AZC.pdb: