Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVRTTRLY 5ME0 Chain:U ((2-57)) -PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHA--------------

General information: TITO was launched using: RESULT: Template: 5ME0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain U - contact count / total energy / energy per contact / energy per residue : 60 1998 33.30 35.68 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain U : 0.85 3D Compatibility (PKB) : 33.30 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.769

(partial model without unconserved sides chains): PDB file : Tito_5ME0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5ME0-query.scw PDB file : Tito_Scwrl_5ME0.pdb: