Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPPERPENDKTQKAKDNITGQISKYEKIVSYEGREAANNGGLRKALEDFARTGEKVGTKNPSNHIQKARDILRGLDNQEKLLQKSTINSQDKAVLQQRIQSLRNEIEPSLKRAITKQNELN 3FC6 Chain:B ((143-196)) ----------------------------------------------EDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQ---------------------

General information: TITO was launched using: RESULT: Template: 3FC6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 43 -3976 -92.47 -73.63 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -92.47 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.462

(partial model without unconserved sides chains): PDB file : Tito_3FC6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FC6-query.scw PDB file : Tito_Scwrl_3FC6.pdb: