Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFQGYSKDRREETCSYCGAIYIVDIPGLPGHEEREEYFCPECSHVNFARASNSPRVSLVKARTDGKNDKSPSFQALIDSYKDE 5M06 Chain:A ((29-66)) -FAGYTVVRML-GCSAMGEVYLVQHPGFPG-----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5M06.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 48 -4544 -94.67 -162.29 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -94.67 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.634

(partial model without unconserved sides chains): PDB file : Tito_5M06.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5M06-query.scw PDB file : Tito_Scwrl_5M06.pdb: