Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDINDYEDAEDSAVDEDEAKAAESGAADEEAGNLTDADLAEAETLTVTAKQKQRQALEDEVAAFLARGGRITEVPPDEHSDR 5HKK Chain:G ((233-280)) -------------------AKASEFGARMTAMGNATDNATEMLETLTLQFNRARQAAITQEIAEIVA----------------

General information: TITO was launched using: RESULT: Template: 5HKK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 4 -206 -51.38 -4.28 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain G : 0.74 3D Compatibility (PKB) : -51.38 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.775

(partial model without unconserved sides chains): PDB file : Tito_5HKK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5HKK-query.scw PDB file : Tito_Scwrl_5HKK.pdb: