Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKILVRNLDRSVTEAEVLELFKAYGKVESCVVVTDKDTGKSKGFGFVEMPNPHEAIKAIKGLNTLKVKGYGIRVKAAEE 1FNX Chain:H ((7-81)) --LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYA--

General information: TITO was launched using: RESULT: Template: 1FNX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 268 -47972 -179.00 -639.62 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain H : 0.85 3D Compatibility (PKB) : -179.00 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.684

(partial model without unconserved sides chains): PDB file : Tito_1FNX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FNX-query.scw PDB file : Tito_Scwrl_1FNX.pdb: