Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLQRGIYQHYKGNLYQVFSVAKHSETEEELVVYQCLYGDYSTWVRPLDMFTETVQMSDGSIVPRFKLIQST 2QC1 Chain:B ((1-35)) -------------------------KSEHETRLEAKLFEDYSSVVRPVEDHREIVQVTVG------------

General information: TITO was launched using: RESULT: Template: 2QC1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 14 -634 -45.29 -18.11 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -45.29 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.006

(partial model without unconserved sides chains): PDB file : Tito_2QC1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QC1-query.scw PDB file : Tito_Scwrl_2QC1.pdb: