Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRYILIALLIIVFGYSLALVLQNPTELPVDLLFTQVPAMRLGLLLLLTLALGIVVGLLLGVQVFRVFQKSWEIKRLRKDIDHLRKEQIQSAQLAAAEAAANVRHEKTVVDIYPQDKNSTPL 2LF0 Chain:A ((8-46)) -----------------------------------------------------------------------EIKRLSDRLDAIRHQQADLSLVEAADKYAELEKEKATLE-----------

General information: TITO was launched using: RESULT: Template: 2LF0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 54 3983 73.75 102.12 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : 73.75 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.627

(partial model without unconserved sides chains): PDB file : Tito_2LF0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LF0-query.scw PDB file : Tito_Scwrl_2LF0.pdb: