Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRVLSKPQRKTQYNLRIDQELHEWLKEVAAKNERPVNYVINQAIKNMRKEIEGAKA 2BNW Chain:A ((5-49)) -------DIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYL----

General information: TITO was launched using: RESULT: Template: 2BNW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 53 -7346 -138.59 -163.23 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -138.59 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.713

(partial model without unconserved sides chains): PDB file : Tito_2BNW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2BNW-query.scw PDB file : Tito_Scwrl_2BNW.pdb: