Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVNHQIKVLQALASAIAEGGRGVTGTAFPKQPVRALKLYEFEGSPFCRRIREVITLLNLD-GLCCTNLLKADFTKSYQIQGTTRV 4E8H Chain:A ((3-45)) -------------------------------PVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGE-------------

General information: TITO was launched using: RESULT: Template: 4E8H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 82 -14276 -174.10 -356.90 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -174.10 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.445

(partial model without unconserved sides chains): PDB file : Tito_4E8H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E8H-query.scw PDB file : Tito_Scwrl_4E8H.pdb: