Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQQPDQKELFEVLEKQKKNQL-QVDRIFKIVLPIVAFLLSVICANFNWQSTLGTFVILTVTFIAVGVKRLPLWHWLIVITIYCLVDNYLSYGQLDVTHLRLQLGTMLVFVGMVGIGRPYVDRWFMKNH 2X5H Chain:B ((4-29)) ----SLKEIIDELGKQAKEQNKIASRIMKI--------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2X5H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 30 1630 54.33 65.20 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain B : 0.42 3D Compatibility (PKB) : 54.33 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.42 QMean score : 0.778

(partial model without unconserved sides chains): PDB file : Tito_2X5H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2X5H-query.scw PDB file : Tito_Scwrl_2X5H.pdb: