Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 4DXE Chain:H ((26-97)) ---------ENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAEKINTVGDAVKFIN----

General information: TITO was launched using: RESULT: Template: 4DXE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 261 -42344 -162.24 -588.11 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain H : 0.87 3D Compatibility (PKB) : -162.24 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.87 QMean score : 0.688

(partial model without unconserved sides chains): PDB file : Tito_4DXE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4DXE-query.scw PDB file : Tito_Scwrl_4DXE.pdb: