Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKKMIYFLGSLITVLSSFIYLKKKKQAEKSEGLSKYQGTWFFSDSQQKQQLQITSDYTF-LINGQSLGTSVVEIDEYRLVVRDQYGF---YLIFSYPEQTLYDESADTSYKLLSEK 4E0Z Chain:A ((167-235)) ------------------------------------------------KQDMQALWDAEIAIMNGRAQTTIISYITKYRNAIREAFGDDHPMLKIATGDAAMYDEAARVKMEKIANK

General information: TITO was launched using: RESULT: Template: 4E0Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 124 2584 20.84 39.75 target 2D structure prediction score : 0.20 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 20.84 2D Compatibility (Sec. Struct. Predict.) : 0.20 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.307

(partial model without unconserved sides chains): PDB file : Tito_4E0Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E0Z-query.scw PDB file : Tito_Scwrl_4E0Z.pdb: