Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSLSKKLAIQVLNDEAERIKRLIRNQNNSLCISQCKAFEEVVDTQMYGFSRQVGFAVRIGVIGKNEGQLMLSELERELNQLYSEVYQEIYDKKEVGKEE 2ODM Chain:A ((8-85)) -----KNAALKQLTKDADEILHLIKVQLDNL----CPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLH-----------------

General information: TITO was launched using: RESULT: Template: 2ODM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 180 -31755 -176.41 -429.11 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -176.41 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.700

(partial model without unconserved sides chains): PDB file : Tito_2ODM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ODM-query.scw PDB file : Tito_Scwrl_2ODM.pdb: