Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTQEIKKLPVIFLGLFFITVGLNWFLLPHDIASAGVGAIGHLVETAFSIQRSVTVWSINLMMLLLAAVLLGKSVFFKTVAGSLLFPVVLEIVPKVEMISSHF-FSLISGSLL---FSLGVYTLYTVGASNGGITIPPIIFHKFFRLPMPQGLLLTNSLIVFLNYYVFGLLETLFVLLSITVSSLFMKILIRLSPVSRKFE 4MQS Chain:A ((44-123)) -------------------------------------------------------------------VLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTV--------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4MQS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 109 -19243 -176.54 -349.87 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : -176.54 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.186

(partial model without unconserved sides chains): PDB file : Tito_4MQS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4MQS-query.scw PDB file : Tito_Scwrl_4MQS.pdb: