Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAFQLGEDHDSGMNEMNLIPLIDIMLVLMIIFLVTATVANPSIPLTLPKTTAEIIDPPPKAITISINANGEVAWDTQVISLDELQKRFQEAGQGDVKPTVQLRADKESKYDTVAQVMSRASEAGLSDIAFVSEN 4O59 Chain:O ((244-276)) -----------------------------------------------------------------------------------------------------CRLEKPAKYDEIKKVVKQASEGPLKGILGYTED

General information: TITO was launched using: RESULT: Template: 4O59.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain O - contact count / total energy / energy per contact / energy per residue : 38 -3781 -99.50 -114.58 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain O : 0.56 3D Compatibility (PKB) : -99.50 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.387

(partial model without unconserved sides chains): PDB file : Tito_4O59.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4O59-query.scw PDB file : Tito_Scwrl_4O59.pdb: