Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKLLVALGLAATVAL--VGCNKDKAPETG-ATTGEHLENSAQQASADIKSAGDQAASDIATATDNASAKIDAATDHAADATAKAAAETEATARKATADTAQAVENAAADVKKDAQH 3ZI0 Chain:A ((25-113)) ---VLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRA-------QTGVTNIAV-----------IPYHGSDAATRLVEQTEA--------------------------

General information: TITO was launched using: RESULT: Template: 3ZI0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 235 4720 20.08 70.44 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : 20.08 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.262

(partial model without unconserved sides chains): PDB file : Tito_3ZI0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZI0-query.scw PDB file : Tito_Scwrl_3ZI0.pdb: