Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRGIKMNSSIDQDPNRTLTLILYVLYIVAIFTGGLLAIIALIINYVKRSDVQGSIFASHFTWQIRTFWWYLAWNIIAFLPFIFLFFTGENTDLFAGVAISSTVFCVGVIAAAWIWIVYRAIRGLIALNDNRPMYQP- 1NRO Chain:R ((1-18)) -------------------------------------------------------------------------------------------------------------------------------LDPRPKYEPF

General information: TITO was launched using: RESULT: Template: 1NRO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 12 1873 156.08 208.11 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain R : 0.35 3D Compatibility (PKB) : 156.08 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.35 QMean score : 0.980

(partial model without unconserved sides chains): PDB file : Tito_1NRO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NRO-query.scw PDB file : Tito_Scwrl_1NRO.pdb: