Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVGTRHLIYVQHNNEYKVAKYGHWDGLDKNTFEVYQGFNKAPLDSSERFASITSPDSNEGYYQVKFLESFDLDNLPSEEDFIAQLEREKN 4F87 Chain:A ((11-71)) VSGVQGFLFHTDGKE----SYG------------YRAFIN------GVEIGIKDIETVQGFQQI-------IPSINISKSDVEAIRKAMK

General information: TITO was launched using: RESULT: Template: 4F87.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 184 -18175 -98.77 -297.94 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -98.77 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.356

(partial model without unconserved sides chains): PDB file : Tito_4F87.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4F87-query.scw PDB file : Tito_Scwrl_4F87.pdb: