Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMTQFVHYQNKQPRDNRRNVNLNDSETMLFDAMSRITGTPIAIIIREFALRHAIRLIMDTDQSILDRIMNTGAPEHLQRG 2JXG Chain:B ((47-84)) -------------ATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFN-----------------------------

General information: TITO was launched using: RESULT: Template: 2JXG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 74 -9214 -124.51 -242.46 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : -124.51 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.648

(partial model without unconserved sides chains): PDB file : Tito_2JXG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JXG-query.scw PDB file : Tito_Scwrl_2JXG.pdb: