Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DCTIERRLGTQTKARARTSAKAMPEMIPAESGKHTVIAGTRVWVYGDCRTYPTHLPDGSTISGRPFQASDVEEDC 2F0Z Chain:A ((301-363)) ---------THSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTG-PDGSPLFGCLYEANDYEE--

General information: TITO was launched using: RESULT: Template: 2F0Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 160 -3372 -21.08 -53.52 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -21.08 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.138

(partial model without unconserved sides chains): PDB file : Tito_2F0Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2F0Z-query.scw PDB file : Tito_Scwrl_2F0Z.pdb: