Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH 2H46 Chain:E ((8-83)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 2H46.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 217 -20885 -96.24 -274.80 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain E : 1.00 3D Compatibility (PKB) : -96.24 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.731

(partial model without unconserved sides chains): PDB file : Tito_2H46.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2H46-query.scw PDB file : Tito_Scwrl_2H46.pdb: