Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHA-SKLSIDEEVYFENLMQLVEHY 2ABL Chain:A ((146-221)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 2ABL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -25245 -97.47 -336.59 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -97.47 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.672

(partial model without unconserved sides chains): PDB file : Tito_2ABL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ABL-query.scw PDB file : Tito_Scwrl_2ABL.pdb: