Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFKTFLKDKEKIVNALQLPYSNAKLEATNNLIKLIKHNAFGFRNFENFKKERTKFVLSRSSLSSTHYS 3FXD Chain:C ((8-43)) ------EQKETILKALNDAIEKGPWDKSN-FLRVIGKKLIAIR-------------------------

General information: TITO was launched using: RESULT: Template: 3FXD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 43 -5810 -135.10 -161.38 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain C : 0.71 3D Compatibility (PKB) : -135.10 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.355

(partial model without unconserved sides chains): PDB file : Tito_3FXD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FXD-query.scw PDB file : Tito_Scwrl_3FXD.pdb: