Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MEFLLYTISKVKLLEDILMPQPIVPVEIPQSRPFDSKKRNDILLKIRIGKLEVSFFQSLNLEMVEQLLDKVLLYDNSSI 1X2M Chain:A ((1-64)) GSSGSSGTAQPNAILEKVFTAITKHP---------DEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSGPSSG-------

General information: TITO was launched using: RESULT: Template: 1X2M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 149 10015 67.21 158.97 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 67.21 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.138

(partial model without unconserved sides chains): PDB file : Tito_1X2M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1X2M-query.scw PDB file : Tito_Scwrl_1X2M.pdb: