Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTN----FNSNEKF-----------CGKSLKSLSADEMS---LIYGAS-DGAEPRWTPTP----IILKSA---AASSKVCISAAVS-GIGGLVSYNNDCLG- 2WBX Chain:A ((1-102)) MQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGD

General information: TITO was launched using: RESULT: Template: 2WBX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 210 7610 36.24 102.84 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : 36.24 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.181

(partial model without unconserved sides chains): PDB file : Tito_2WBX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WBX-query.scw PDB file : Tito_Scwrl_2WBX.pdb: