Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTTSSATTPIEINALGQPCPMPLLMLKRELKKLSGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQISEREFHYLIETQ 1PAV Chain:A ((3-77)) ------VKPDRVIDARGSYCPGPLMELIKAYKQAKVGEVISVYSTDAGTKKDAPAWIQKSGQELVGVFDRNGYYEIVMKKV

General information: TITO was launched using: RESULT: Template: 1PAV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 491 -36434 -74.20 -485.79 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -74.20 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.256

(partial model without unconserved sides chains): PDB file : Tito_1PAV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PAV-query.scw PDB file : Tito_Scwrl_1PAV.pdb: