Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MKMLAQLQNRF--DQWVEQIVQYLDRL-----SVRERIMVVFT-TIFVVVVIVG-YSLWKMHSLAEQQQKRLNDLK--DLMVWMQSNAVTMKPANELELDKSGKIQRVAQQQGLTV---SSQQNGEQL---QIVVTHQNYAILANFLIQLAQMGLS--IQKMEMVSSEGQIKLTATV
4TSD Chain:A ((2-180))AIFGELSSLGHLFKKTQELEILHEYLKEVMQKGSKANQRVLNLATNTEFQVPLGHGIFSIEQSYCLEHAKESEKGFFESHKKYVDFQLIVKGVEGAKAVGINQAVIKNPYDEKRDLIVYEPVSEASFLRLHAGMLAIFFENDAHALRFYGESFEKYREEPIFKAVVKAPKGLIKLKLAA


General information:
TITO was launched using:
RESULT:

Template: 4TSD.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 706 26415 37.42 167.18
target 2D structure prediction score : 0.37
Monomeric hydrophicity matching model chain A : 0.68

3D Compatibility (PKB) : 37.42
2D Compatibility (Sec. Struct. Predict.) : 0.37
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.221

(partial model without unconserved sides chains):
PDB file : Tito_4TSD.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4TSD-query.scw
PDB file : Tito_Scwrl_4TSD.pdb: