Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVRTTRLY 2IZU Chain:A ((236-274)) ------KRATPIEVLCENFP---EMATYLRYVRRLDFFEKPDYDYLRK-----------------------

General information: TITO was launched using: RESULT: Template: 2IZU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 55 -4433 -80.60 -113.67 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -80.60 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.665

(partial model without unconserved sides chains): PDB file : Tito_2IZU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IZU-query.scw PDB file : Tito_Scwrl_2IZU.pdb: