Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRIIKEPVMSEFEGKSGKWAWEIQKEQQANLDELRSSIEYLVQKYKHDAHASSIFGDQDKTRIYNRFVNQLEHLLKGDA 2MH3 Chain:A ((26-95)) ----MKPKTASEHRKSSK--PIMEKRRRARINESLSQLKTLILDALKKD--SSRHSKLEKADILEMTVKHLRNLQRAQ-

General information: TITO was launched using: RESULT: Template: 2MH3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 91 -146 -1.60 -2.09 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -1.60 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.576

(partial model without unconserved sides chains): PDB file : Tito_2MH3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MH3-query.scw PDB file : Tito_Scwrl_2MH3.pdb: