Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLIHY-----PVYFFFELIQASCNEYIASGSNKEDIMLLNRKHSLV--SCFDLELLETHPVKIKNSK--VKQKNFITVSLEFSFKKIPPIF-------
1O7B Chain:T ((1-98))GVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAK


General information:
TITO was launched using:
RESULT:

Template: 1O7B.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 293 12377 42.24 150.94
target 2D structure prediction score : 0.38
Monomeric hydrophicity matching model chain T : 0.63

3D Compatibility (PKB) : 42.24
2D Compatibility (Sec. Struct. Predict.) : 0.38
1D Compatibility (Hydrophobicity) : 0.63
QMean score : 0.151

(partial model without unconserved sides chains):
PDB file : Tito_1O7B.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1O7B-query.scw
PDB file : Tito_Scwrl_1O7B.pdb: