Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR
1WKK Chain:A ((1-137))--MERTFVMIKPDGVRRGLVGEILARFERKGFRIAALKLMQISQELAERHYAEHREKPFFPGLVRFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIRGDFATTIDENVIHGSATLEDAQREIALFFRPEELL----


General information:
TITO was launched using:
RESULT:

Template: 1WKK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 625 -73467 -117.55 -536.26
target 2D structure prediction score : 0.62
Monomeric hydrophicity matching model chain A : 0.85

3D Compatibility (PKB) : -117.55
2D Compatibility (Sec. Struct. Predict.) : 0.62
1D Compatibility (Hydrophobicity) : 0.85
QMean score : 0.477

(partial model without unconserved sides chains):
PDB file : Tito_1WKK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1WKK-query.scw
PDB file : Tito_Scwrl_1WKK.pdb: