Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLQRG-IYQHYKGNLYQVFSVAKHSETEEELVVYQCLYGDYSTWVRPLDMFTETVQMSDGSIVPRFKLIQST 2V57 Chain:C ((44-61)) --VGRSTVHRYYPER----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2V57.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 5 -972 -194.40 -81.00 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain C : 0.48 3D Compatibility (PKB) : -194.40 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.498

(partial model without unconserved sides chains): PDB file : Tito_2V57.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2V57-query.scw PDB file : Tito_Scwrl_2V57.pdb: