Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQQLMIMVTEVGKLEHTCNLLAEVNKGGKVIKVFDYNGNELSMNMDGIVTFNRKRWELPVKVDLK 1AVW Chain:B ((3-21)) --------------------------------VLDNEGNPLENGG--------------------

General information: TITO was launched using: RESULT: Template: 1AVW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 11 667 60.59 51.27 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : 60.59 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.733

(partial model without unconserved sides chains): PDB file : Tito_1AVW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1AVW-query.scw PDB file : Tito_Scwrl_1AVW.pdb: