Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWYFAWILGILMACFAGVLSALYIEHHQNLDEE 2JOD Chain:B ((21-28)) -KYLAAVLG------------------------

General information: TITO was launched using: RESULT: Template: 2JOD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 -874 -291.17 -109.19 target 2D structure prediction score : 0.13 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : -291.17 2D Compatibility (Sec. Struct. Predict.) : 0.13 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.389

(partial model without unconserved sides chains): PDB file : Tito_2JOD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JOD-query.scw PDB file : Tito_Scwrl_2JOD.pdb: