Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRLKVVIKDQFDQESIALAKVRPANDQKLELYKSVEHIEIDDDIILPNMDLLYENPKDGKIYKLVGPFNEDEL 1A2O Chain:B ((255-269)) --------------------------------------------RHRPSVDVLFHSVAK---------------

General information: TITO was launched using: RESULT: Template: 1A2O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 8 -265 -33.13 -17.67 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -33.13 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.144

(partial model without unconserved sides chains): PDB file : Tito_1A2O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1A2O-query.scw PDB file : Tito_Scwrl_1A2O.pdb: