Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQMDQKRIHVGLITSFVTMLIYLDQGHLTWTVVGVVGFLTLFTAIKK 5IV3 Chain:A ((142-169)) ------RVKIGLAAGHISMLVFGDETHSHFLVIG-------------

General information: TITO was launched using: RESULT: Template: 5IV3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 32 -9245 -288.89 -330.16 target 2D structure prediction score : 0.21 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -288.89 2D Compatibility (Sec. Struct. Predict.) : 0.21 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.349

(partial model without unconserved sides chains): PDB file : Tito_5IV3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5IV3-query.scw PDB file : Tito_Scwrl_5IV3.pdb: