Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MSKIYIIKEMLFDQLLFGISSKQNGKVYGATLPFCFSNTQVSL
2WAQ Chain:Q ((38-82))IQIIELLMKNTEIWDNLLNGKISVDEAKRLFEDNYKDYEKRDSRR


General information:
TITO was launched using:
RESULT:

Template: 2WAQ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain Q - contact count / total energy / energy per contact / energy per residue : 44 2602 59.13 60.50
target 2D structure prediction score : 0.47
Monomeric hydrophicity matching model chain Q : 0.64

3D Compatibility (PKB) : 59.13
2D Compatibility (Sec. Struct. Predict.) : 0.47
1D Compatibility (Hydrophobicity) : 0.64
QMean score : -0.014

(partial model without unconserved sides chains):
PDB file : Tito_2WAQ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2WAQ-query.scw
PDB file : Tito_Scwrl_2WAQ.pdb: