Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFRRYPYSDSSNSEEKRRKNMKYFQLVLTLITAMVIEVLEQKLA 5BRM Chain:G ((7-28)) ----GMKRNATSPQVQRPSFMDYFD-------------------

General information: TITO was launched using: RESULT: Template: 5BRM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 6 1057 176.17 50.33 target 2D structure prediction score : 0.10 Monomeric hydrophicity matching model chain G : 0.52 3D Compatibility (PKB) : 176.17 2D Compatibility (Sec. Struct. Predict.) : 0.10 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.580

(partial model without unconserved sides chains): PDB file : Tito_5BRM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5BRM-query.scw PDB file : Tito_Scwrl_5BRM.pdb: