Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAIFVLGIYVTQLVIKNKFLYFFAFSKTEYAKIRGYIATLNKR 3DBJ Chain:H ((19-35)) ------------------------LDTAAMEKLKAYFATGELR

General information: TITO was launched using: RESULT: Template: 3DBJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 6 -979 -163.17 -57.59 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain H : 0.50 3D Compatibility (PKB) : -163.17 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.595

(partial model without unconserved sides chains): PDB file : Tito_3DBJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DBJ-query.scw PDB file : Tito_Scwrl_3DBJ.pdb: