Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSCTTEGTDEKEVIFYFEVSTLFVVNNLEQTQNASTVIYQ-- 1EWS Chain:A ((1-32)) MPCSCKKYCDP----------WEVIDGSCGLFNSKYICCREK

General information: TITO was launched using: RESULT: Template: 1EWS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 83 -1729 -20.83 -57.62 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -20.83 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.125

(partial model without unconserved sides chains): PDB file : Tito_1EWS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1EWS-query.scw PDB file : Tito_Scwrl_1EWS.pdb: