Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY 2MV7 Chain:B ((876-900)) -----------------------------------------TNKLPVSIPLASVVLPSRAERARST--------

General information: TITO was launched using: RESULT: Template: 2MV7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 5 -1894 -378.70 -75.74 target 2D structure prediction score : 0.12 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -378.70 2D Compatibility (Sec. Struct. Predict.) : 0.12 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.118

(partial model without unconserved sides chains): PDB file : Tito_2MV7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MV7-query.scw PDB file : Tito_Scwrl_2MV7.pdb: