Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence METGTVKWFNSEKGFGFITAENGNDVFVHFSAIQGDGFKTLEEGQAVTFDVEEGQRGPQATNVTKA 5JX4 Chain:A ((3-65)) MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQ--GFKTLEEGQEVSFEIVQGNRGPQAANVVK-

General information: TITO was launched using: RESULT: Template: 5JX4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -30151 -106.92 -478.58 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.90 3D Compatibility (PKB) : -106.92 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.90 QMean score : 0.681

(partial model without unconserved sides chains): PDB file : Tito_5JX4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JX4-query.scw PDB file : Tito_Scwrl_5JX4.pdb: