Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTQEIKKLPVIFLGLFFITVGLNWFLLPHDIASAGVGAIGHLVETAFSIQRSVTVWSINLMMLLLAAVLLGKSVFFKTVAGSLLFPVVLEIVPKVEMISSHFFSLISGSLLFSLGVYTLYTVGASNGGITIPPIIFHKFFRLPMPQGLLLTNSLIVFLNYYVFGLLETLFVLLSITVSSLFMKILIRLSPVSRKFE 1RQT Chain:B ((22-32)) -----------------------------------------------------------------------------------------------------------------------------------LISAMEEKFGV------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1RQT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 -1074 -358.00 -97.64 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain B : 0.33 3D Compatibility (PKB) : -358.00 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.33 QMean score : 0.314

(partial model without unconserved sides chains): PDB file : Tito_1RQT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RQT-query.scw PDB file : Tito_Scwrl_1RQT.pdb: