Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG 3ZK1 Chain:G ((9-86)) --IVLGCSAVGAGLAM-IAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLYANPFLS

General information: TITO was launched using: RESULT: Template: 3ZK1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 158 -21972 -139.06 -281.69 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain G : 0.86 3D Compatibility (PKB) : -139.06 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.500

(partial model without unconserved sides chains): PDB file : Tito_3ZK1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZK1-query.scw PDB file : Tito_Scwrl_3ZK1.pdb: